PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn141491
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HD-ZIP
Protein Properties Length: 345aa    MW: 38808 Da    PI: 10.1302
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn141491genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-18181235256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Achn141491 181 RKKLRLSKDQSAILEESFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTK 235
                 788899***********************************************98 PP

2HD-ZIP_I/II128.62.7e-41181270191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LEesF+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
   Achn141491 181 RKKLRLSKDQSAILEESFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELR-AL 270
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.3E-2081157IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466892.13E-18169238IPR009057Homeodomain-like
PROSITE profilePS5007117.232177237IPR001356Homeobox domain
SMARTSM003899.6E-17179241IPR001356Homeobox domain
CDDcd000862.39E-15181238No hitNo description
PfamPF000464.8E-16181235IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.9E-18186235IPR009057Homeodomain-like
PRINTSPR000313.8E-5208217IPR000047Helix-turn-helix motif
PROSITE patternPS000270212235IPR017970Homeobox, conserved site
PRINTSPR000313.8E-5217233IPR000047Helix-turn-helix motif
SMARTSM003404.2E-27237280IPR003106Leucine zipper, homeobox-associated
PfamPF021832.8E-11237271IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MAPTRGAHLP NHTNTQAKAT LFLGNSRTCT CTCAFPSING SQCLLPIEWL KTSPPVKAYR  60
AGSMKTRMRK LRLRYRYTTK INPHSVTARE YTRVKLIQDL FASDGNDRNS DTCRGDARPF  120
LRGIDVNRPA ADGEDDAGVS SPNSTLSSVS GKRSEREATG DETERASSHG ISDEEDADGS  180
RKKLRLSKDQ SAILEESFKE HNTLNPKQKL ALAKRLGLRP RQVEVWFQNR RARTKLKQTE  240
VDCEFLKRCC ENLTEENRRL QKEVQELRAL KLSPQFYMQM TPPTTLTMCP SCEHVGIPPS  300
SSSAPLDHHR PRPHPIHPRP IPIHPWAPTT PVPHRPFDAL HPRS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179185SRKKLRL
2229237RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002263193.11e-133PREDICTED: homeobox-leucine zipper protein HAT4
SwissprotQ054661e-103HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLD7TG791e-133D7TG79_VITVI; Putative uncharacterized protein
STRINGVIT_00s0299g00100.t011e-133(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-99homeobox protein 2